IGF-1LR3, 1mg

$120.00

SKU IG1 Category
  • Product Name: IGF-1LR3
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Molecular Formula: C400H625N111O115S9
  • Molecular Weight: 9117.60 g/mol 
  • Research Only: Yes
  • Form: Lyophilized Solid
  • Purity: >99%
  • Storage: Keep refrigerated upon reconstitution

Some COAs may contain redactions of confidential or proprietary information. These redactions do not impact or obscure any analytical data, including compound identity, purity, or test results.

Out of stock

Description

IGF-1LR3 is a synthetic, long-acting analog of human IGF-1. Modified to prevent binding protein interference, it stays active for 20–30 hours. It stimulates muscle growth (hyperplasia), fat loss, and tissue repair.

IGF-1LR3 is not approved by the U.S. Food and Drug Administration for human use. Its safety, efficacy, and pharmacological profile have not been established in approved FDA clinical trials. This compound is intended strictly for laboratory research purposes and is not for human or veterinary use.

Lyophilized Peptides

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. 

Disclaimer: For Research Purposes only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.