LL-37, 5mg

$48.00

SKU 375 Category
  • Product Name: LL-37
  • Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4493.37
  • Research Only: Yes
  • Form: Lyophilized Solid
  • Purity: >99%
  • Storage: Keep refrigerated upon reconstitution

Availability: 20 in stock

We offer free shipping for orders over $400

LL-37 Description

LL-37 is a human cathelicidin-derived peptide that has been extensively studied in research settings for its role in innate immune processes. It is generated from the precursor protein hCAP18 and is expressed in cell types such as neutrophils, epithelial cells, and keratinocytes. Structurally, LL-37 adopts an α-helical conformation under physiological conditions, which is associated with its interaction with biological membranes.

Antimicrobial Research

LL-37 has been investigated for its activity against a range of microorganisms in vitro, including both Gram-positive and Gram-negative bacteria. Experimental findings suggest it may interact with microbial membranes through mechanisms such as membrane disruption and binding to bacterial components (e.g., lipopolysaccharides). Reported activity can vary depending on environmental conditions and organism type, and some resistance has been observed in certain models.

Immunological Research

In addition to its antimicrobial properties, LL-37 has been studied for its role in modulating immune-related pathways. Research indicates it may influence cytokine signaling, immune cell activation, and inflammatory responses in controlled experimental systems. These effects appear to be context-dependent and are not yet fully characterized.

Tissue and Wound Research

LL-37 has been examined in models of tissue repair, where it has been associated with cellular processes such as keratinocyte migration and proliferation. Studies have explored its interaction with signaling pathways involved in cellular growth and tissue remodeling. Observations from preclinical models suggest a potential role in epithelial responses to injury, though these findings remain limited to research environments.

Chemotaxis and Cell Signaling

LL-37 has been reported to exhibit chemotactic properties in experimental studies, with observed interactions involving various immune cell types, including neutrophils, monocytes, and other leukocytes. Proposed mechanisms include activity through formyl peptide receptors and related signaling pathways. These findings are based on in vitro and animal models and require further investigation.

LL-37 is not approved by the U.S. Food and Drug Administration for human use. Its safety, efficacy, and pharmacological profile have not been established in approved FDA clinical trials. This compound is intended strictly for laboratory research purposes and is not for human or veterinary use.

Lyophilized Peptides

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. 

Disclaimer: For Research Purposes only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.